I just started creating an app with Streamlit and have a problem, that the text does not comply with container (column) width:
sequences = []
labels = ["first", "second"]
with st.form(key="fasta_dropdown"):
f_cols = st.columns(2)
for i, col in enumerate(f_cols):
id = col.selectbox(
f"Select {labels[i]} FASTA", fasta_df["ID"], key=i
)
seq = get_sequence_by_id(fasta_df, id)
sequences.append(seq)
with col.expander(label="View sequence"):
st.markdown("""
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMK
ASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHV
LHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG
"""
)
dropdown_submit = st.form_submit_button("Apply sequences")
How can I fix that? Putting the text into HTML formatting with style="width: 10%" does not change anything.
You can use the CSS property word-wrap:break-word;, which will break words if they are too long for your width.
Code:
st.markdown("""<span style="word-wrap:break-word;">MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMK
ASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHV
LHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG</span>""", unsafe_allow_html=True)
Example:
import streamlit as st
col1, col2 = st.columns(2)
col1.subheader("Col 1")
col1.markdown("""<span style="word-wrap:break-word;">MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMK
ASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHV
LHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG</span>""", unsafe_allow_html=True)
col2.subheader("Col 2")
col2.markdown("""<span style="word-wrap:break-word;">MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMK
ASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHV
LHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG</span>""", unsafe_allow_html=True)
Output:
Related
I have created a small form with ipywidgets. The sample code can be run in Jupyter or Google colab.
Each time the form is filled and the button is clicked a row gets added to a dataframe. Subsequently the dataframe gets displayed.
My problem is that the output displays the new updated dataframe on top of the old one. What I want is that the new display output overwrites the old one. See image description here.
import ipywidgets as widgets
from ipywidgets import HBox, Label
from ipywidgets import Layout, Button, Box, FloatText, Textarea, Dropdown, Label, IntSlider
import time
import pandas as pd
#Create DF
df = df = pd.DataFrame(columns = ['Dropdown_column', 'Float_column'])
df
# Layout
form_item_layout = Layout(
display='flex',
flex_flow='row',
justify_content='space-between',
)
button_item_layout = Layout(
display='flex',
flex_flow='row',
justify_content='center',
padding = '5%'
)
# Dropdown item
drop_down_input = 'Dropdown_input_1'
drop_down = widgets.Dropdown(options=[('Dropdown_input_1', 'Dropdown_input_1'), ('Dropdown_input_2','Dropdown_input_2'), ('Dropdown_input_3', 'Dropdown_input_3')])
def dropdown_handler(change):
global drop_down_input
print('\r','Dropdown: ' + str(change.new),end='')
drop_down_input = change.new
drop_down.observe(dropdown_handler, names='value')
# FloatText item
float_input = 0
FloatText = widgets.FloatText()
def IntText_handler(change):
global float_input
print('\r','Float text:' + str(change.new),end='')
float_input = change.new
FloatText.observe(IntText_handler, names='value')
# Button
button = widgets.Button(description='Add row to dataframe')
out = widgets.Output()
def on_button_clicked(b):
global df
button.description = 'Row added'
time.sleep(1)
with out:
new_row = {'Dropdown_column': drop_down_input, 'Float_column': float_input}
df = df.append(new_row, ignore_index=True)
button.description = 'Add row to dataframe'
display(df)
button.on_click(on_button_clicked)
# Form items
form_items = [
Box([Label(value='Dropdown'),
drop_down], layout=form_item_layout),
Box([Label(value='FloatText'),
FloatText], layout=form_item_layout),
Box([Label(value=''), button],
layout=button_item_layout),
]
form = Box(form_items, layout=Layout(
display='flex',
flex_flow='column',
border='solid 1px',
align_items='stretch',
width='30%',
padding = '1%'
))
display(form)
display(out)
I have tried using the print() function in combination with '/r' and changing #button part of my code.
Change:
display(df)
to
print('\r',str(df), end='')
or
print(str(df), end='\r')
But this does not work either.
Does somebody have any idea what to do?
\r works only for single line of normal text but df is not displayed as normal text (and it is not single line) but as HTML code.
You have to use out.clear_output() to remove previous content.
with out:
new_row = {'Dropdown_column': drop_down_input, 'Float_column': float_input}
df = df.append(new_row, ignore_index=True)
button.description = 'Add row to dataframe'
out.clear_output() # <---
display(df)
You can see more about out.clear_output() in documentation:
Output widgets: leveraging Jupyter’s display system
I need bit of assistance with my python code. I am a newbie to python so not very good at it.
I have an excel spreadsheet with a bunch of lecture times and I am using the code below;
df = pd.read_excel('/home/pi/timetable1.xlsx')
df['Date'] = pd.to_datetime(df['Date']).dt.strftime("%d-%m-%Y")
now = pd.to_datetime('today').strftime("%d-%m-%Y")
print(df[df['Date'] == now])
which displays a simple line of timetable text such as below [xx:xx is time in 24 hr format];
Lesson 1: Lesson 2: Lesson 3: Lession 4: Lesson 5:
xx:xx xx:xx xx:xx xx:xx xx:xx
I have configured it so that the above displayed times only shows the times for the "Current Date".
What I am trying to acheive is that I want to use PyQt4 to display this information on a graphical window.
So for example, the below displays "HELLO WORLD" text in the gui window;
def wxfinished():
attribution3.setText("HELLO WORLD")
attribution3 = QtGui.QLabel(foreGround)
attribution3.setObjectName("attribution3")
attribution3.setStyleSheet("#attribution3 { " +
"background-color: transparent; color: " +
Config.textcolor +
"; font-size: " +
str(int(50 * xscale)) + #50 is the size of the text
"px; " +
Config.fontattr +
"}")
attribution3.setAlignment(Qt.AlignTop)
attribution3.setGeometry(450 * xscale, 670 * yscale, 1000 * xscale, 1000)
w.show()
w.showFullScreen()
sys.exit(app.exec_())
How can I change it so that instead of "HELLO WORLD" I can print out the timetable output?
While I'm not that familiar with Pandas, here's an MRE to help you. In this, a table is made, the labels are set to the excel's labels (lesson x), and the singular row is filled out with the dates.
from PyQt4.QtGui import QApplication, QTableWidget, QLabel, QFont
from PyQt4.QtCore import Qt
import sys
import pandas
CELL_FONT = QFont()
CELL_FONT.setPointSize(8)
def getLessions(): # assuming the code you provided works
"""
Returns Pandas DataFrame object w/ today's date info
:return:
"""
data = pandas.read_excel("path")
date = pandas.to_datatime(data["Date"]).dtftime("%d-%m-%Y")
now = pandas.to_datetime('today').strftime("%d-%m-%Y")
return data[date == now]
def makeWidget():
datum = getLessions()
columns = len(datum.columns)
# Use table to display information
table = QTableWidget()
table.setRowCount(1)
table.setColumnCount(columns)
table.setHorizontalHeaderLabels(datum.columns) # I think datum.columns returns [str], I could be wrong
table.setVerticalHeaderLabels([""])
# Row will be filled with Labels w/ times
for i in range(columns):
lession_time = str(datum.iloc[0,i]) # edit: iloc returns a Timestamp object
label = QLabel()
label.setFont(CELL_FONT)
label.setText(lession_time)
label.setAlignment(Qt.AlignHCenter | Qt.AlignBottom)
table.setCellWidget(0, i, label)
return table
def makeWidgetDummy(): # Doesn't use Pandas
columns = 5
table = QTableWidget()
table.setRowCount(1)
table.setColumnCount(columns)
horizontal_lbls = ["Lesson {}".format(i + 1) for i in range(columns)]
table.setHorizontalHeaderLabels(horizontal_lbls)
table.setVerticalHeaderLabels([""])
for i in range(columns):
lession_time = "XX:XX"
label = QLabel()
label.setFont(CELL_FONT)
label.setText(lession_time)
label.setAlignment(Qt.AlignHCenter | Qt.AlignBottom)
table.setCellWidget(0, i, label)
def main():
app = QApplication(sys.argv)
widget = makeWidget()
# widget = makeWidgetDummy()
widget.show()
app.exec_()
if __name__ == "__main__":
main()
I want to convert an xlsx with Python. I used the modules tablib and xtopdf to build a well structured table. Works excellent! Unfortunately the content does not fit on one pdf page. So I wanted to change the pagesize and format to horizontal A3. But I don't know how that could work. My code:
import random
import tablib
from openpyxl import load_workbook
from xtopdf import PDFWriter
from pyPdf import PdfFileWriter, PdfFileReader
workbook = load_workbook('C:/Users/user1/Testexcel.xlsx', guess_types=True, data_only=True)
worksheet = workbook.get_sheet_by_name('Testsheet')
ws_range = worksheet.iter_rows('A4:H6')
# Helper function to output a string to both screen and PDF.
def print_and_write(pw, strng):
print strng
pw.writeLine(strng)
# Create an empty Dataset and set its headers.
data = tablib.Dataset()
data.headers = ['col1', 'col2', 'col3', 'col4']
widths = [30, 20, 10, 20] # Display widths for columns.
for row in ws_range:
col1 = str(row[0].value)
col2 = str(row[1].value)
col3 = str(row[2].value)
col4 = str(row[3].value)
columns = [col1, col2, col3, col4]
row = [ str(col).center(widths[idx]) for idx, col in enumerate(columns) ]
data.append(row)
# Set up the PDFWriter.
pw = PDFWriter('C:/Users/user1/Test.pdf')
pw.setFont('Courier', 10)
pw.setHeader('Test')
pw.setFooter('Test')
# Generate header and data rows as strings; output them to screen and PDF.
separator = '-' * sum(widths)
print_and_write(pw, separator)
# Output headers
header_strs = [ header.center(widths[idx]) for idx, header in enumerate(data.headers) ]
print_and_write(pw, ''.join(header_strs))
print_and_write(pw, separator)
# Output data
for row in data:
print_and_write(pw, ''.join(row))
print_and_write(pw, separator)
pw.close()
Found out that the PDFWriter from xtopdf itself instanciates an canvas object of the reportlab library. In the canvas class an attribute pagesize is declared which is setted by default to 'A4'. But if I change the entry to 'A3' the result pdf still is in 'A4'.
class Canvas(textobject._PDFColorSetter):
from reportlab.pdfgen import canvas
c = canvas.Canvas("hello.pdf")
from reportlab.lib.units import inch
# move the origin up and to the left
c.translate(inch,inch)
# define a large font
c.setFont("Helvetica", 80)
# choose some colors
c.setStrokeColorRGB(0.2,0.5,0.3)
c.setFillColorRGB(1,0,1)
# draw a rectangle
c.rect(inch,inch,6*inch,9*inch, fill=1)
# make text go straight up
c.rotate(90)
# change color
c.setFillColorRGB(0,0,0.77)
# say hello (note after rotate the y coord needs to be negative!)
c.drawString(3*inch, -3*inch, "Hello World")
c.showPage()
c.save()
"""
def __init__(self,filename,
pagesize='A3',
bottomup = 1,
pageCompression=None,
encoding = None,
invariant = None,
verbosity=0):
"""Create a canvas of a given size. etc.
You may pass a file-like object to filename as an alternative to
a string.
Most of the attributes are private - we will use set/get methods
as the preferred interface. Default page size is A4."""
if pagesize is None: pagesize = 'A3'
if encoding is None: encoding = rl_config.defaultEncoding
if invariant is None: invariant = rl_config.invariant
self._filename = filename
self._encodingName = encoding
self._doc = pdfdoc.PDFDocument(encoding,
compression=pageCompression,
invariant=invariant, filename=filename)
#this only controls whether it prints 'saved ...' - 0 disables
self._verbosity = verbosity
#this is called each time a page is output if non-null
self._onPage = None
self._pagesize = pagesize
self._pageRotation = 0
#self._currentPageHasImages = 0
self._pageTransition = None
self._pageDuration = None
self._destinations = {} # dictionary of destinations for cross indexing.
self.setPageCompression(pageCompression)
self._pageNumber = 1 # keep a count
#self3 = [] #where the current page's marking operators accumulate
# when we create a form we need to save operations not in the form
self._codeStack = []
self._restartAccumulators() # restart all accumulation state (generalized, arw)
self._annotationCount = 0
self._outlines = [] # list for a name tree
self._psCommandsBeforePage = [] #for postscript tray/font commands
self._psCommandsAfterPage = [] #for postscript tray/font commands
#PostScript has the origin at bottom left. It is easy to achieve a top-
#down coord system by translating to the top of the page and setting y
#scale to -1, but then text is inverted. So self.bottomup is used
#to also set the text matrix accordingly. You can now choose your
#drawing coordinates.
self.bottomup = bottomup
self.imageCaching = rl_config.defaultImageCaching
self._make_preamble()
self.init_graphics_state()
self.state_stack = []
edit: I think the changes in the reportlab module are not accepted by the system. Tried to remove the dictionary reportlab and tried to import it then in the commandline. Ironically it works ylthough python should not find that module anymore.
try this
from reportlab.pdfgen import canvas
from reportlab.lib.units import mm
c = canvas.Canvas("hello.pdf", pagesize = (297 * mm, 420 * mm))
# or (420 * mm, 297 * mm) if you want it in portrait format
# values for inch: 11.69 * inch , 16.53 * inch
#the following would create an empty page
c.showPage()
c.save()
Just forked a project named xtopdf at bitbucket and made the following change:
##------------------------ PDFWriter.__init__ ----------------------------
- def __init__(self, pdf_fn):
+ def __init__(self, pdf_fn, pagesize='A4'):
'''
Constructor.
"pdf_fn" arg is the name of the PDF file to be created.
'''
self.__pdf_fn = pdf_fn # file name of PDF file
- self.__canv = canvas.Canvas(pdf_fn) # canvas to write on
+ self.__canv = canvas.Canvas(pdf_fn, pagesize) # canvas to write on
self.__font_name = None # font name
self.__font_size = None # font size
self.__header_str = None # header string (partial)
Can you try it? use pw = PDFWriter('C:/Users/user1/Test.pdf', 'A3').
I'm able to use a paragraph object to select font size, color, bold, etc. within a table cell. But, add_paragraph() seems to always insert a leading \n into the cell and this messes up the formatting on some tables.
If I just use the cell.text('') method it doesn't insert this newline but then I can't control the text attributes.
Is there a way to eliminate this leading newline?
Here is my function:
def add_table_cell(table, row, col, text, fontSize=8, r=0, g=0, b=0, width=-1):
cell = table.cell(row,col)
if (width!=-1):
cell.width = Inches(width)
para = cell.add_paragraph(style=None)
para.alignment = WD_ALIGN_PARAGRAPH.LEFT
run = para.add_run(text)
run.bold = False
run.font.size = Pt(fontSize)
run.font.color.type == MSO_COLOR_TYPE.RGB
run.font.color.rgb = RGBColor(r, g, b)
I tried the following and it worked out for me. Not sure if is the best approach:
cells[0].text = 'Some text' #Write the text to the cell
#Modify the paragraph alignment, first paragraph
cells[0].paragraphs[0].paragraph_format.alignment=WD_ALIGN_PARAGRAPH.CENTER
The solution that I find is to use text attribute instead of add_paragraph() but than use add_run():
row_cells[0].text = ''
row_cells[0].paragraphs[0].add_run('Total').bold = True
row_cells[0].paragraphs[0].paragraph_format.alignment = WD_ALIGN_PARAGRAPH.RIGHT
I've look through the documentation of cell, and it's not the problem of add_paragraph(). The problem is when you having a cell, by default, it will have a paragraph inside it.
class docx.table._Cell:
paragraphs: ... By default, a new cell contains a single paragraph. Read-only
Therefore, if you want to add paragraphs in the first row of cell, you should first delete the default paragraph first. Since python-docx don't have paragraph.delete(), you can use the function mention in this github issue: feature: Paragraph.delete()
def delete_paragraph(paragraph):
p = paragraph._element
p.getparent().remove(p)
p._p = p._element = None
Therefore, you should do something like:
cell = table.cell(0,0)
paragraph = cell.paragraphs[0]
delete_paragraph(paragraph)
paragraph = cell.add_paragraph('text you want to add', style='style you want')
Update at 10/8/2022
Sorry, the above approach is kinda unnecessary.
It's much intuitive to edit the default paragraph instead of first deleting it and add it back.
For the function add_table_cell, just replace the para = cell.paragraphs[0]
and para.style = None, the para.style = None is not necessary as it should be default value for a new paragraph.
Here is what worked for me. I don't call add_paragraph(). I just reference the first paragraph with this call -> para = cell.paragraphs[0]. Everything else after that is the usual api calls.
table = doc.add_table( rows=1, cols=3 ) # bar codes
for tableRow in table.rows:
for cell in tableRow.cells:
para = cell.paragraphs[0]
run = para.add_run( "*" + specIDStr + "*" )
font = run.font
font.name = 'Free 3 of 9'
font.size = Pt( 20 )
run = para.add_run( "\n" + specIDStr
+ "\n" + firstName + " " + lastName
+ "\tDOB: " + dob )
font = run.font
font.name = 'Arial'
font.size = Pt( 8 )
I have to edit a pptx template which contain tables like this:
How to append values stored in my python dict to the empty fields?
I'm using a pptx module, but I couldn't find any example of doing this.
from pptx import Presentation
prs = Presentation('template.pptx')
slide = prs.slides[2] #<- This is the slide that contains the table
shape = slide.shapes #<- As I understood This gives access to the shapes
textframe=shape.textframe
textframe.clear()
prs.save('test.pptx') #<- Saves the new file
pptx module link
quote from the dev-group of python-ppty developer
-if you know its index, something like table = slide.shapes[2] would do the trick.
Then you'll need to navigate the cells before you can change their contents:
for idx, row in enumerate(table.rows):
if idx = 0: # skip header row
continue
name_cell = row.cells[0]
name_cell.text = 'foobar'
corners_cell = row.cells[1]
---in main----
table_data = [['ID', 'Name', 'Age', 'Second name'], ['1', 'Petro', 22, 'Petrovich'], ['2', 'Ivan', 32, 'Ivanovich'], ['3', 'Oles', 23, 'Marko']]
prs = Presentation(template_filepath)
slide_1 = slide_build(prs, 5)
table_draw(table_data, slide_1.shapes)
prs.save(result_filepath)
def slide_build(prs, layout):
slide = prs.slides.add_slide(prs.slide_layouts[layout])
return slide
def table_draw(table_data, shapes):
rows_number = 0
columns_number = 0
# get table size
rows_number = len(table_data)
for i, item in enumerate(table_data):
columns_number += 1
table = table_build(rows_number, columns_number, shapes)
column_coord = 0
row_coord = 0
for row_count, row in enumerate(table_data):
for item_count, row_item in enumerate(row):
table.cell(row_count + row_coord, item_count + column_coord).text = str(row_item)
def table_build(rows, cols, shapes):
left = (0.1)
top = Inches(0.7)
width = Inches(6.0)
height = Inches(0.8)
table = shapes.add_table(rows, cols, left, top, width, height).table
# set column widths
i = 0
while i
Some thing like this