We Keep Coding

How to find the most amount of shared characters in two strings? (Python)

yamxxopd
yndfyamxx
Output: 5
I am not quite sure how to find the number of the most amount of shared characters between two strings. For example (the strings above) the most amount of characters shared together is "yamxx" which is 5 characters long.
xx would not be a solution because that is not the most amount of shared characters. In this case the most is yamxx which is 5 characters long so the output would be 5.
I am quite new to python and stack overflow so any help would be much appreciated!
Note: They should be the same order in both strings

Here is simple, efficient solution using dynamic programming.
def longest_subtring(X, Y):
m,n = len(X), len(Y)
LCSuff = [[0 for k in range(n+1)] for l in range(m+1)]
result = 0
for i in range(m + 1):
for j in range(n + 1):
if (i == 0 or j == 0):
LCSuff[i][j] = 0
elif (X[i-1] == Y[j-1]):
LCSuff[i][j] = LCSuff[i-1][j-1] + 1
result = max(result, LCSuff[i][j])
else:
LCSuff[i][j] = 0
print (result )
longest_subtring("abcd", "arcd") # prints 2
longest_subtring("yammxdj", "nhjdyammx") # prints 5

This solution starts with sub-strings of longest possible lengths. If, for a certain length, there are no matching sub-strings of that length, it moves on to the next lower length. This way, it can stop at the first successful match.
s_1 = "yamxxopd"
s_2 = "yndfyamxx"
l_1, l_2 = len(s_1), len(s_2)
found = False
sub_length = l_1 # Let's start with the longest possible sub-string
while (not found) and sub_length: # Loop, over decreasing lengths of sub-string
for start in range(l_1 - sub_length + 1): # Loop, over all start-positions of sub-string
sub_str = s_1[start:(start+sub_length)] # Get the sub-string at that start-position
if sub_str in s_2: # If found a match for the sub-string, in s_2
found = True # Stop trying with smaller lengths of sub-string
break # Stop trying with this length of sub-string
else: # If no matches found for this length of sub-string
sub_length -= 1 # Let's try a smaller length for the sub-strings
print (f"Answer is {sub_length}" if found else "No common sub-string")
Output:
Answer is 5

s1 = "yamxxopd"
s2 = "yndfyamxx"
# initializing counter
counter = 0
# creating and initializing a string without repetition
s = ""
for x in s1:
if x not in s:
s = s + x
for x in s:
if x in s2:
counter = counter + 1
# display the number of the most amount of shared characters in two strings s1 and s2
print(counter) # display 5

Optimize python code to avoid runtime error

Given a string that might have multiple occurrences of the same character, return the closest same character of any indicated character in the string.
Given the string s and n number of queries. In each query, you are given an index a (where 0 <= a <= |s| ) of a character, and you need to print the index of the closet same character. If there are multiple answers, print the smallest one. Otherwise, print -1.
For example, string s = 'youyouy', with a given query 3: there are two matching character at indices 0 and 6, each 3 away, we choose the smallest one which is 0.
Here is my plan:
I put the string in a dictionary, the key is distinct letters in a string, values are letters corresponding indexes. When given a query, find the corresponding letter in the dictionary and return the closest value to the query.
def closest(s, queries):
res = []
dict2={}
#dict2 - letter - indexs
for i in range(len(s)):
if s[i] not in dict2:
dict2[s[i]]=[i]
else:
dict2[s[i]].append(i)
for num in queries:
#closet- denotes closet letter index
closet = math.inf
#num is out of range , append -1
if num > (len(s)-1):
res.append(-1)
continue
#this is the only one letter, append -1
letter=s[num]
if len(dict2[letter])==1:
res.append(-1)
continue
#temp = list for that letters
temp=dict2[s[num]]
index=temp.index(num) . #in the list, letter index's index in list
if index==0:
closet=temp[1]
elif index==(len(temp)-1):
closet=temp[index-1]
else:
distance1=num-temp[index-1] . #left
distance2=temp[index+1]-num . #right
if distance1 <= distance2:
closet=temp[index-1]
else:
closet=temp[index+1]
if closet == math.inf:
res.append(-1)
else:
res.append(closet)
return res
I got two runtime error. I am wondering if you could help me out to maybe reduce some run time ?
Also, I am looking for another suggestions! I have used Python for a while, and I am looking for a job (university new grad). Is java usually running faster than Python? Should I switch to Java?

Im trying to do as simple as i can , but i look like a bit complex. Though you question is avoiding runtime error , i want to present my idea
s='oooyyouoy'
k='0123456789'
def cloest(string,pos):
c = string[pos]
p1 , p2 = s[:pos] , s[pos+1:]
# reserve left part and find the closet one , add 1 because len(p1)=final_position + 1
l = len(p1) - (p1[::-1].find(c) + 1)
# find without reserve and add 1 because s[pos+1:]
r = (p2.find(c) + 1) + pos
# judge which one is closer if same chose left one
result = l if (pos - l) <= (r - pos) else r
if result == pos:
return -1
else:
return result
print(cloest(s,4))

Removing duplicates if paired adjacently

Deleting any pair of adjacent letters with same value. For example, string "aabcc" would become either "aab" or "bcc" after operation.
Sample input = aaabccddd
Sample output = abd
Confused how to iterate the list or the string in a way to match the duplicates and removing them, here is the way I am trying and I know it is wrong.
S = input()
removals = []
for i in range(0, len(S)):
if i + 1 >= len(S):
break
elif S[i] == S[i + 1]:
removals.append(i)
# removals is to store all the indexes that are to be deleted.
removals.append(i + 1)
i += 1
print(i)
Array = list(S)
set(removals) #removes duplicates from removals
for j in range(0, len(removals)):
Array.pop(removals[j]) # Creates IndexOutOfRange error
This is a problem from Hackerrank: Super Reduced String

Removing paired letters can be reduced to reducing runs of letters to an empty sequence if there are an even number of them, 1 if there are an odd number. aaaaaa becomes empty, aaaaa is reduced to a.
To do this on any sequence, use itertools.groupby() and count the group size:
# only include a value if their consecutive count is odd
[v for v, group in groupby(sequence) if sum(1 for _ in group) % 2]
then repeat until the size of the sequence no longer changes:
prev = len(sequence) + 1
while len(sequence) < prev:
prev = len(sequence)
sequence = [v for v, group in groupby(sequence) if sum(1 for _ in group) % 2]
However, since Hackerrank gives you text it'd be faster if you did this with a regular expression:
import re
even = re.compile(r'(?:([a-z])\1)+')
prev = len(text) + 1
while len(text) < prev:
prev = len(text)
text = even.sub(r'', text)
[a-z] in a regex matches a lower-case letter, (..)groups that match, and\1references the first match and will only match if that letter was repeated.(?:...)+asks for repeats of the same two characters.re.sub()` replaces all those patterns with empty text.
The regex approach is good enough to pass that Hackerrank challenge.

You can use stack in order to achieve O(n) time complexity. Iterate over the characters in a string and for each character check if the top of stack contains the same character. In case it does pop the character from stack and move to next item. Otherwise push the character to the stack. Whatever remains in the stack is the result:
s = 'aaabccddd'
stack = []
for c in s:
if stack and stack[-1] == c:
stack.pop()
else:
stack.append(c)
print ''.join(stack) if stack else 'Empty String' # abd
Update Based on the discussion I ran couple of tests to measure the speed of regex and stack based solutions with input length of 100. Tests were run on Python 2.7 on Windows 8:
All same
Regex: 0.0563033799756
Stack: 0.267807865445
Nothing to remove
Regex: 0.075074750044
Stack: 0.183467329017
Worst case
Regex: 1.9983200193
Stack: 0.196362265609
Alphabet
Regex: 0.0759905517997
Stack: 0.182778728207
Code used for benchmarking:
import re
import timeit
def reduce_regexp(text):
even = re.compile(r'(?:([a-z])\1)+')
prev = len(text) + 1
while len(text) < prev:
prev = len(text)
text = even.sub(r'', text)
return text
def reduce_stack(s):
stack = []
for c in s:
if stack and stack[-1] == c:
stack.pop()
else:
stack.append(c)
return ''.join(stack)
CASES = [
['All same', 'a' * 100],
['Nothing to remove', 'ab' * 50],
['Worst case', 'ab' * 25 + 'ba' * 25],
['Alphabet', ''.join([chr(ord('a') + i) for i in range(25)] * 4)]
]
for name, case in CASES:
print(name)
res = timeit.timeit('reduce_regexp(case)',
setup='from __main__ import reduce_regexp, case; import re',
number=10000)
print('Regex: {}'.format(res))
res = timeit.timeit('reduce_stack(case)',
setup='from __main__ import reduce_stack, case',
number=10000)
print('Stack: {}'.format(res))

extract substring pattern

I have long file like 1200 sequences
>3fm8|A|A0JLQ2
CFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTP
QKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLP
>2ht9|A|A0JLT0
LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDA
LYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
I want to read each possible pattern has cysteine in middle and has in the beginning five string and follow by other five string such as xxxxxCxxxxx
the output should be like this:
QDIQLCGMGIL
ILPEHCIIDIT
TISDNCVVIFS
FSKTSCSYCTM
this is the pogram only give position of C . it is not work like what I want
pos=[]
def find(ch,string1):
for i in range(len(string1)):
if ch == string1[i]:
pos.append(i)
return pos
z=find('C','AWERQRTCWERTYCTAAAACTTCTTT')
print z

You need to return outside the loop, you are returning on the first match so you only ever get a single character in your list:
def find(ch,string1):
pos = []
for i in range(len(string1)):
if ch == string1[i]:
pos.append(i)
return pos # outside
You can also use enumerate with a list comp in place of your range logic:
def indexes(ch, s1):
return [index for index, char in enumerate(s1)if char == ch and 5 >= index <= len(s1) - 6]
Each index in the list comp is the character index and each char is the actual character so we keep each index where char is equal to ch.
If you want the five chars that are both sides:
In [24]: s="CFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTP QKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLP"
In [25]: inds = indexes("C",s)
In [26]: [s[i-5:i+6] for i in inds]
Out[26]: ['QDIQLCGMGIL', 'ILPEHCIIDIT']
I added checking the index as we obviously cannot get five chars before C if the index is < 5 and the same from the end.
You can do it all in a single function, yielding a slice when you find a match:
def find(ch, s):
ln = len(s)
for i, char in enumerate(s):
if ch == char and 5 <= i <= ln - 6:
yield s[i- 5:i + 6]
Where presuming the data in your question is actually two lines from yoru file like:
s="""">3fm8|A|A0JLQ2CFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLP
>2ht9|A|A0JLT0LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCY"""
Running:
for line in s.splitlines():
print(list(find("C" ,line)))
would output:
['0JLQ2CFLVNL', 'QDIQLCGMGIL', 'ILPEHCIIDIT']
['TISDNCVVIFS', 'FSKTSCSYCTM', 'TSCSYCTMAKK']
Which gives six matches not four as your expected output suggest so I presume you did not include all possible matches.
You can also speed up the code using str.find, starting at the last match index + 1 for each subsequent match
def find(ch, s):
ln, i = len(s) - 6, s.find(ch)
while 5 <= i <= ln:
yield s[i - 5:i + 6]
i = s.find(ch, i + 1)
Which will give the same output. Of course if the strings cannot overlap you can start looking for the next match much further in the string each time.

My solution is based on regex, and shows all possible solutions using regex and while loop. Thanks to #Smac89 for improving it by transforming it into a generator:
import re
string = """CFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLP
LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDA LYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL"""
# Generator
def find_cysteine2(string):
# Create a loop that will utilize regex multiple times
# in order to capture matches within groups
while True:
# Find a match
data = re.search(r'(\w{5}C\w{5})',string)
# If match exists, let's collect the data
if data:
# Collect the string
yield data.group(1)
# Shrink the string to not include
# the previous result
location = data.start() + 1
string = string[location:]
# If there are no matches, stop the loop
else:
break
print [x for x in find_cysteine2(string)]
# ['QDIQLCGMGIL', 'ILPEHCIIDIT', 'TISDNCVVIFS', 'FSKTSCSYCTM', 'TSCSYCTMAKK']

How do you reverse the words in a string using python (manually)? [duplicate]

This question already has answers here:
Closed 11 years ago.
Possible Duplicate:
Reverse the ordering of words in a string
I know there are methods that python already provides for this, but I'm trying to understand the basics of how those methods work when you only have the list data structure to work with. If I have a string hello world and I want to make a new string world hello, how would I think about this?
And then, if I can do it with a new list, how would I avoid making a new list and do it in place?

Split the string, make a reverse iterator then join the parts back.
' '.join(reversed(my_string.split()))
If you are concerned with multiple spaces, change split() to split(' ')
As requested, I'm posting an implementation of split (by GvR himself from the oldest downloadable version of CPython's source code: Link)
def split(s,whitespace=' \n\t'):
res = []
i, n = 0, len(s)
while i < n:
while i < n and s[i] in whitespace:
i = i+1
if i == n:
break
j = i
while j < n and s[j] not in whitespace:
j = j+1
res.append(s[i:j])
i = j
return res
I think now there are more pythonic ways of doing that (maybe groupby) and the original source had a bug (if i = n:, corrrected to ==)

Original Answer
from array import array
def reverse_array(letters, first=0, last=None):
"reverses the letters in an array in-place"
if last is None:
last = len(letters)
last -= 1
while first < last:
letters[first], letters[last] = letters[last], letters[first]
first += 1
last -= 1
def reverse_words(string):
"reverses the words in a string using an array"
words = array('c', string)
reverse_array(words, first=0, last=len(words))
first = last = 0
while first < len(words) and last < len(words):
if words[last] != ' ':
last += 1
continue
reverse_array(words, first, last)
last += 1
first = last
if first < last:
reverse_array(words, first, last=len(words))
return words.tostring()
Answer using list to match updated question
def reverse_list(letters, first=0, last=None):
"reverses the elements of a list in-place"
if last is None:
last = len(letters)
last -= 1
while first < last:
letters[first], letters[last] = letters[last], letters[first]
first += 1
last -= 1
def reverse_words(string):
"""reverses the words in a string using a list, with each character
as a list element"""
characters = list(string)
reverse_list(characters)
first = last = 0
while first < len(characters) and last < len(characters):
if characters[last] != ' ':
last += 1
continue
reverse_list(characters, first, last)
last += 1
first = last
if first < last:
reverse_list(characters, first, last=len(characters))
return ''.join(characters)
Besides renaming, the only change of interest is the last line.

You have a string:
str = "A long string to test this algorithm"
Split the string (at word boundary -- no arguments to split):
splitted = str.split()
Reverse the array obtained -- either using ranges or a function
reversed = splitted[::-1]
Concatenate all words with spaces in between -- also known as joining.
result = " ".join(reversed)
Now, you don't need so many temps, combining them into one line gives:
result = " ".join(str.split()[::-1])

str = "hello world"
" ".join(str.split()[::-1])