Python calculate ORFs from any arbitrary reading frame - python

I have a big fasta file in this format:
>gi|142022655|gb|EQ086233.1|522 marine metagenome JCVI_SCAF_1096627390048 genomic scaffold, whole genome shotgun sequence
AAGACGGGCACCGTGTCCTTCGCGACGTACTCCGACCAGTTGTACACGTTCAGGTTGGTGTCGCCGGCAT
GGGCCGACAGGCTGGCCGCGACGGCCAGCGCCGCCGACGTGACGCGCGCGGCGCGCAACGCCGATTGACG
ACGGATACGGATACGCATGGGGATTCTCCTTGTGATGGGGATCGGCCGTTGCGCCCGGTCCGGGTCCGGA
CTCGCGTCAACGCCGTCGAGCGGTGTTCAGCACAAGGGCCAATGTAGAGATCGCGGCCGGCAGCGTCAGT
CCCGAAAACCGGGACAAACGGCGACGTCGATTCCCGCCGTTTGGGTAGATTCCCGCGTAGGCAGTCGAAA
ATATTCGTGATACCTGTAGCGCCACCTGAAAATCTTCGATACACGACGCCATGAGCGCTGCGCTGCCCGC
CCCCGATCTTCCGCTGAGCCACGTCGCGTTCGTGACTGAAACGCTGGGCGACATCGCACAAGCCGTCGGA
ACGCCGCAGTTCATGCGCGCCGTCTACGACACGCTCGTGCGCTACGTCGATTTCGACGCCGTGCACCTCG
ACTACGAGCGCAGCGCGTCTTCCGGCCGGCGCAGCGTCGGCTGGATCGGCAGCTTCGGCCGCGAGCCCGA
GCTGGTCGCGCAGGTGATGCGCCACTACTACCGCAGCTACGCGAGCGACGATGCAACTTACGCGGCGATC
GAAACCGAAAACGACGTGCAATTGCTGCAGGTGTCCGCGCAACGCGTGTCGAGCGAGCTACGGCATCTGT
TCTTCGATGCCGGCGACATTCATGACGAATGCGTGATCGCCGGCGTGACGGGCGGCACGCGCTACTCGAT
CTCGATCGCGCGCTCACGGCGGCTGCCGCCGTTTTCGCTGAAGGAACTGAGCCTGCTGAAGCAGCTTTCG
CAAGTCGTGCTGCCGCTGGCGTCCGCGCACAAGCGCCTGCTCGGCGCGATCTCCGCCGACGACGCACCGC
GCGACGAACTCGATCTCGACCTCGTCGCGCAATGGCTGCCGGAATGGCAGGAACGGTTGACCGCGCGCGA
GATGCATGTGTGTGCGTCGTTCATCCAGGGCATGACGTCGGCGGCCATCGCCCAATCGATGGGGCTCAAG
ACCTCCACCGTCGATACCTACGCGAAGCGCGCCTTCGCGAAGCTCGGCGTCGATTCGCGAAGGCAACTGA
TGACCCTCGTGCTGAGAAACGCGTCGCGGCGGCATGACGCATAGCATCC
>gi|142022655|gb|EQ086233.1|598 marine metagenome JCVI_SCAF_1096627390048 genomic scaffold, whole genome shotgun sequence
TTGCCGCCGGCCGCAGCCGGCTTGGCACCACGCTGCGGCTGGTCGCCGGACTTCGGCTTCGCGCCGGTGT
CCGCCGGCGCTGCCGGCCGCTTCGCGTTGCGCTCCTGCTTGGCCTTCGCTGCGAGCTGCGCCCGCAATTC
GGCAAGTTGTTCAAAACCCATAAATTCAATCCACCAGGAATATAAGGTGTGGTTCGTGCGGCCATGCCGC
GCGGCGCACGAGCTTCGCCGCCATGCGTGCGACCCGTCTGCCGCCGATGCGGAATACTACGGGGCCGCAT
>gi|142022655|gb|EQ086233.1|143 marine metagenome JCVI_SCAF_1096627390048 genomic scaffold, whole genome shotgun sequence
CTGATGCGTGCGCGCGGCCGCCTGCAGCCAGCGCGTCAGTTCCGGCGCCGCCGCGCGGCTGTAGTTCAGCGCG
CCGCCGCGATCGACGGGCAGGTAATGGCCTTCGATGTCGATGCCGTCCGGCGGCGTGTTCGAGTTCGCGA
TCGAGCCGAACTTGCCGGTCTTGCGCGCCTCGACGTACGTGCCGTCGTCGACGTACTGGATCTTCAGGTC
GACGCCGAGCCGCTGCCGCGCCTGCGCCTGCAGCGCCTGCAGCAGCACGTCGCGCTGGTCGCGCACGGTC
I want to be able to find out the length of the longest open reading frame (ORF) appearing in reading frame 3 of any of the sequences?
So far, I have tried some code that lists out all the ORFs of one sequence, inputted as a string:
import re
from string import maketrans
pattern = re.compile(r'(?=(ATG(?:...)*?)(?=TAG|TGA|TAA))')
def revcomp(dna_seq):
return dna_seq[::-1].translate(maketrans("ATGC","TACG"))
def orfs(dna):
return set(pattern.findall(dna) + pattern.findall(revcomp(dna)))
print orfs(Seq)
where Seq='''CTGATGCGTGCGCGCGGCCGCCTGCAGCCAGCGCGTCAGTTCCGGCGCCGCCGCGCGGCTGTAGTTCAGCGCGCCGCCGCGATCGACGGGCAGGTAATGGCCTTCGATGTCGATGCCGTCCGGCGGCGTGTTCGAGTTCGCGATCGAGCCGAACTTGCCGGTCTTGCGCGCCTCGACGTACGTGCCGTCGTCGACGTACTGGATCTTCAGGTCGACGCCGAGCCGCTGCCGCGCCTGCGCCTGCAGCGCCTGCAGCAGCACGTCGCGCTGGTCGCGCACGGTC''' Notice that this is the 3rd entry in the big fasta file format above.
My sample output to this is: set([]), so I am clearly doing something terribly wrong. My code doesn't even scale to multiple entries (i.e., it only takes a single DNA string, called Seq)
Can anyone point me in the right direction please?
EDIT:
N.B.: ATG is the start codon (i.e., the beginning of an ORF) and TAG, TGA, and TAA are stop codons (i.e., the end of an ORF).

EDITED 1: Completely rewritten to better match problem description.
I don't know the exact file format here, so am assuming it carries on the same way as the three sequences you show -- one sequence after another.
If I understand correctly, the reason you didn't see a match in the third sequence is that there actually isn't a match there. There are matches in the first two, though, and you will see them if you run this.
'''
import re
import string
with open('dna.txt', 'rb') as f:
data = f.read()
data = [x.split('\n', 1) for x in data.split('>')]
data = [(x[0], ''.join(x[1].split())) for x in data if len(x) == 2]
start, end = [re.compile(x) for x in 'ATG TAG|TGA|TAA'.split()]
revtrans = string.maketrans("ATGC","TACG")
def get_longest(starts, ends):
''' Simple brute-force for now. Optimize later...
Given a list of start locations and a list
of end locations, return the longest valid
string. Returns tuple (length, start position)
Assume starts and ends are sorted correctly
from beginning to end of string.
'''
results = {}
# Use smallest end that is bigger than each start
ends.reverse()
for start in starts:
for end in ends:
if end > start and (end - start) % 3 == 0:
results[start] = end + 3
results = [(end - start, start) for
start, end in results.iteritems()]
return max(results) if results else (0, 0)
def get_orfs(dna):
''' Returns length, header, forward/reverse indication,
and longest match (corrected if reversed)
'''
header, seqf = dna
seqr = seqf[::-1].translate(revtrans)
def readgroup(seq, group):
return list(x.start() for x in group.finditer(seq))
f = get_longest(readgroup(seqf, start), readgroup(seqf, end))
r = get_longest(readgroup(seqr, start), readgroup(seqr, end))
(length, index), s, direction = max((f, seqf, 'forward'), (r, seqr, 'reverse'))
return length, header, direction, s[index:index + length]
# Process entire file
all_orfs = [get_orfs(x) for x in data]
# Put in groups of 3
all_orfs = zip(all_orfs[::3], all_orfs[1::3], all_orfs[2::3])
# Process each group of 3
for x in all_orfs:
x = max(x) # Only pring longest in each group
print(x)
print('')

Your requirements aren't clear to me. In your question you say "I want to be able to find out the length of the longest open reading frame (ORF) appearing in reading frame 3 of any of the sequences?" In subsequent comments, you say "I'm only interested in the comprehensive calculation of each ORF from any arbitrary reading frame. They are ALL important to me."
Assuming that the later is what you're after, here's a simple way to get all the ORFs from a collection of sequences in fasta format, using BioPython to look after much of the work.
import io # Only needed because input is in string form
from Bio import Seq, SeqIO
import regex as re
startP = re.compile('ATG')
def get_orfs(nuc):
orfs = []
for m in startP.finditer(nuc, overlapped=True):
pro = Seq.Seq(nuc)[m.start():].translate(to_stop=True)
orfs.append(nuc[m.start():m.start()+len(pro)*3+3])
return orfs
for fasta in SeqIO.parse(io.StringIO(fasta_inputs), 'fasta'):
header = fasta.description
orfs = get_orfs(str(fasta.seq))
print(header, orfs)
Notes:
Normally you'd read a fasta collection from a file. Since here it's in string format, we used io.StringIO to make it easily compatible with SeqIO.parse from BioPython
The get_orfs function finds ATGs and returns the ORG originating from each one. If you're also interested in frames 4 through 6, you'll need the reverse_complement of the sequence.
If you're only interested in the longest ORF from each fasta sequence, you could have the get_orfs function return (max(orfs, key=len))
It's marginally more difficult if you're only interested in ORFs starting with ATG in a specific frame (e.g. frame 3). The simplest approach there might be to simply find all ORFs from the frame and then discard those not starting with ATG.

Related

How do I quickly extract data from this massive csv file?

I have genomic data from 16 nuclei. The first column represents the nucleus, the next two columns represent the scaffold (section of genome) and the position on the scaffold respectively, and the last two columns represent the nucleotide and coverage respectively. There can be equal scaffolds and positions in different nuclei.
Using input for start and end positions (scaffold and position of each), I'm supposed to output a csv file which shows the data (nucleotide and coverage) of each nucleus within the range from start to end. I was thinking of doing this by having 16 columns (one for each nucleus), and then showing the data from top to bottom. The leftmost region would be a reference genome in that range, which I accessed by creating a dictionary for each of its scaffolds.
In my code, I have a defaultdict of lists, so the key is a string which combines the scaffold and the location, while the data is an array of lists, so that for each nucleus, the data can be appended to the same location, and in the end each location has data from every nucleus.
Of course, this is very slow. How should I be doing it instead?
Code:
#let's plan this
#input is start and finish - when you hit first, add it and keep going until you hit next or larger
#dictionary of arrays
#loop through everything, output data for each nucleus
import csv
from collections import defaultdict
inrange = 0
start = 'scaffold_41,51335'
end = 'scaffold_41|51457'
locations = defaultdict(list)
count = 0
genome = defaultdict(lambda : defaultdict(dict))
scaffold = ''
for line in open('Allpaths_SL1_corrected.fasta','r'):
if line[0]=='>':
scaffold = line[1:].rstrip()
else:
genome[scaffold] = line.rstrip()
print('Genome dictionary done.')
with open('automated.csv','rt') as read:
for line in csv.reader(read,delimiter=','):
if line[1] + ',' + line[2] == start:
inrange = 1
if inrange == 1:
locations[line[1] + ',' + line[2]].append([line[3],line[4]])
if line[1] + ',' + line[2] == end:
inrange = 0
count += 1
if count%1000000 == 0:
print('Checkpoint '+str(count)+'!')
with open('region.csv','w') as fp:
wr = csv.writer(fp,delimiter=',',lineterminator='\n')
for key in locations:
nuclei = []
for i in range(0,16):
try:
nuclei.append(locations[key][i])
except IndexError:
nuclei.append(['',''])
wr.writerow([genome[key[0:key.index(',')][int(key[key.index(',')+1:])-1],key,nuclei])
print('Done!')
Files:
https://drive.google.com/file/d/0Bz7WGValdVR-bTdOcmdfRXpUYUE/view?usp=sharing
https://drive.google.com/file/d/0Bz7WGValdVR-aFdVVUtTbnI2WHM/view?usp=sharing
(Only focusing on the CSV section in the middle of your code)
The example csv file you supplied is over 2GB and 77,822,354 lines. Of those lines, you seem to only be focused on 26,804,253 lines or about 1/3.
As a general suggestion, you can speed thing up by:
Avoid processing the data you are not interested in (2/3 of the file);
Speed up identifying the data you are interested in;
Avoid the things that repeated millions of times that tend to be slower (processing each line as csv, reassembling a string, etc);
Avoid reading all data when you can break it up into blocks or lines (memory will get tight)
Use faster tools like numpy, pandas and pypy
You data is block oriented, so you can use a FlipFlop type object to sense if you are in a block or not.
The first column of your csv is numeric, so rather than splitting the line apart and reassembling two columns, you can use the faster Python in operator to find the start and end of the blocks:
start = ',scaffold_41,51335,'
end = ',scaffold_41,51457,'
class FlipFlop:
def __init__(self, start_pattern, end_pattern):
self.patterns = start_pattern, end_pattern
self.state = False
def __call__(self, st):
rtr=True if self.state else False
if self.patterns[self.state] in st:
self.state = not self.state
return self.state or rtr
lines_in_block=0
with open('automated.csv') as f:
ff=FlipFlop(start, end)
for lc, line in enumerate(f):
if ff(line):
lines_in_block+=1
print lines_in_block, lc
Prints:
26804256 77822354
That runs in about 9 seconds in PyPy and 46 seconds in Python 2.7.
You can then take the portion that reads the source csv file and turn that into a generator so you only need to deal with one block of data at a time.
(Certainly not correct, since I spent no time trying to understand your files overall..):
def csv_bloc(fn, start_pat, end_pat):
from itertools import ifilter
with open(fn) as csv_f:
ff=FlipFlop(start_pat, end_pat)
for block in ifilter(ff, csv_f):
yield block
Or, if you need to combine all the blocks into one dict:
def csv_line(fn, start, end):
with open(fn) as csv_in:
ff=FlipFlop(start, end)
for line in csv_in:
if ff(line):
yield line.rstrip().split(",")
di={}
for row in csv_line('/tmp/automated.csv', start, end):
di.setdefault((row[2],row[3]), []).append([row[3],row[4]])
That executes in about 1 minute on my (oldish) Mac in PyPy and about 3 minutes in cPython 2.7.
Best

Trying to split a txt file into multiple variables

So I'm making a program where it reads a text file and I need to separate all the info into their own variables. It looks like this:
>1EK9:A.41,52; B.61,74; C.247,257; D.279,289
ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD
YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ
DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT
QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN
YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE
QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN
KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS
SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT
TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV
STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN
The code after the > is a title, the next bit that looks like this "A.41,52" are numbered positions in the sequence I need to save to use, and everything after that is an amino acid sequence. I know how to deal with the amino acid sequence, I just need to know how to separate the important numbers in the first line.
In the past when I just had a title and sequence I did something like this:
for line in nucfile:
if line.startswith(">"):
headerline=line.strip("\n")[1:]
else:
nucseq+=line.strip("\n")
Am I on the right track here? This is my first time, any advice would be fantastic and thanks for reading :)
I suggest you use the split() method.
split() allows you to specify the separator of your choice. Provided the sequence title (here 1EK9) is always separated from the rest of the sequence by a colon, you could first pass ":" as your separator. You could then split the remainder of the sequence to recover the numbered positions (e.g. A.41,52) using ";" as a separator.
I hope this helps!
I think what you are trying to do is extract certain parts of the sequence based on their identifiers given to you on the first line (the line starting with >).
This line contains your title, then a sequence name and the data range you need to extract.
Try this:
sequence_pairs = {}
with open('somefile.txt') as f:
header_line = next(f)
sequence = f.read()
title,components = header_line.split(':')
pairs = components.split(';')
for pair in pairs:
start,end = pair[2:-1].split(',')
sequence_pars[pair[:1]] = sequence[start:int(end)+1]
for sequence,data in sequence_pairs.iteritems():
print('{} - {}'.format(sequence, data))
As the other answer may be very good to tackle the assumed problem in it's entirety - but the OP has requested for pointers or an example of the tpyical split-unsplit transform which is often so successful I hereby provide some ideas and working code to show this (based on the example of the question).
So let us focus on the else branch below:
from __future__ import print_function
nuc_seq = [] # a list
title_token = '>'
with open('some_file_of_a_kind.txt', 'rt') as f:
for line in f.readlines():
s_line = line.strip() # this strips whitespace
if line.startswith(title_token):
headerline = line.strip("\n")[1:]
else:
nuc_seq.append(s_line) # build list
# now nuc_seq is a list of strings like:
# ['ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD',
# 'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ',
# ...
# ]
demo_nuc_str = ''.join(nuc_seq)
# now:
# demo_nuc_str == 'ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYR ...'
That is fast and widely deployed paradigm in Python programming (and programming with powerful datatypes in general).
If the split-unsplit ( a.k.a. join) method is still unclear, just ask or try to sear SO on excellent answers to related questions.
Also note, that there is no need to line.strip('\n') as \nis considered whitespace like ' ' (string with a space only) or a tabulator '\t', sample:
>>> a = ' \t \n '
>>> '+'.join(a.split())
''
So the "joining character" only appears, if there are at least two element sto join and in this case, strip removed all whits space and left us with the empty string.
Upate:
As requested a further analysis of the "coordinate part" in the line called headline of the question:
>1EK9:A.41,52; B.61,74; C.247,257; D.279,289
If you want to retrieve the:
A.41,52; B.61,74; C.247,257; D.279,289
and assume you have (as above the complete line in headline string):
title, coordinate_string = headline.split(':')
# so now title is '1EK9' and
# coordinates == 'A.41,52; B.61,74; C.247,257; D.279,289'
Now split on the semi colons, trim the entries:
het_seq = [z.strip() for z in coordinates.split(';')]
# now het_seq == ['A.41,52', 'B.61,74', 'C.247,257', 'D.279,289']
If 'a', 'B', 'C', and 'D' are well known dimensions, than you can "lose" the ordering info from input file (as you could always reinforce what you already know ;-) and might map the coordinats as key: (ordered coordinate-pair):
>>> coord_map = dict(
(a, tuple(int(k) for k in bc.split(',')))
for a, bc in (abc.split('.') for abc in het_seq))
>>> coord_map
{'A': (41, 52), 'C': (247, 257), 'B': (61, 74), 'D': (279, 289)}
In context of a micro program:
#! /usr/bin/enc python
from __future__ import print_function
het_seq = ['A.41,52', 'B.61,74', 'C.247,257', 'D.279,289']
coord_map = dict(
(a, tuple(int(k) for k in bc.split(',')))
for a, bc in (abc.split('.') for abc in het_seq))
print(coord_map)
yields:
{'A': (41, 52), 'C': (247, 257), 'B': (61, 74), 'D': (279, 289)}
Here one might write this explicit a nested for loop but it is a late european evening so trick is to read it from right:
for all elements of het_seq
split on the dot and store left in a and right in b
than further split the bc into a sequence of k's, convert to integer and put into tuple (ordered pair of integer coordinates)
arrived on the left you build a tuple of the a ("The dimension like 'A' and the coordinate tuple from 3.
In the end call the dict() function that constructs a dictionary using here the form dict(key_1, value_1, hey_2, value_2, ...) which gives {key_1: value1, ...}
So all coordinates are integers, stored ordered pairs as tuples.
I'ld prefer tuples here, although split() generates lists, because
You will keep those two coordinates not extend or append that pair
In python mapping and remapping is often performed and there a hashable (that is immutable type) is ready to become a key in a dict.
One last variant (with no knoted comprehensions):
coord_map = {}
for abc in het_seq:
a, bc = abc.split('.')
coord_map[a] = tuple(int(k) for k in bc.split(','))
print(coord_map)
The first four lines produce the same as above minor obnoxious "one liner" (that already had been written on three lines kept together within parentheses).
HTH.
So I'm assuming you are trying to process a Fasta like file and so the way I would do it is to first get the header and separate the pieces with Regex. Following that you can store the A:42.52 B... in a list for easy access. The code is as follows.
import re
def processHeader(line):
positions = re.search(r':(.*)', line).group(1)
positions = positions.split('; ')
return positions
dnaSeq = ''
positions = []
with open('myFasta', 'r') as infile:
for line in infile:
if '>' in line:
positions = processHeader(line)
else:
dnaSeq += line.strip()
I am not sure I completely understand the goal (and I think this post is more suitable for a comment, but I do not have enough privileges) but I think that the key to you solution is using .split(). You can then join the elements of the resulting list just by using + similar to this:
>>> result = line.split(' ')
>>> result
['1EK9:A.41,52;', 'B.61,74;', 'C.247,257;', 'D.279,289', 'ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD', 'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ', 'DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT', 'QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN',
'YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE', 'QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN', 'KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS', 'SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT', 'TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV', 'STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN']
>>> result[3]+result[4]
'D.279,289ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD'
>>>
etc. You can also use the usual following syntax to extract the elements of the list that you need:
>>> result[5:]
['YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ', 'DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT', 'QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN', 'YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE', 'QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN', 'KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS', 'SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT', 'TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV', 'STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN']
and join them together:
>>> reduce(lambda x, y: x+y, result[5:])
'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN'
remember that + on lists produces a list.
By the way I would not remove '\n' to start with as you may try to use it to extract the first line similar to the above with using space to extract "words".
UPDATE (starting from result):
#getting A indexes
letter_seq=result[5:]
ind=result[:4]
Aind=ind[0].split('.')[1].replace(';', '')
#getting one long letter seq
long_letter_seq=reduce(lambda x, y: x+y, letter_seq)
#extracting the final seq fromlong_letter_seq using Aind
output = long_letter_seq[int(Aind.split(',')[0]):int(Aind.split(',')[1])]
the last line is just a union of several operations that were also used earlier.
Same for B C D etc -- so a lot of manual work and calculations...
BE CAREFUL with indexes of A -- numbering in python starts from 0 which may not be the case in your numbering system.
The more elegant solution would be using re (https://docs.python.org/2/library/re.html) to find pettern using a mask, but this requires very well defined rules for how to look up the sequence needed.
UPDATE2: it is also not clear to me what is the role of spaces -- so far I removed them but they may matter when counting the letters in the original string.

How do I optimize the speed of my python compression code?

I have made a compression code, and have tested it on 10 KB text files, which took no less than 3 minutes. However, I've tested it with a 1 MB file, which is the assessment assigned by my teacher, and it takes longer than half an hour. Compared to my classmates, mine is irregularly long. It might be my computer or my code, but I have no idea. Does anyone know any tips or shortcuts into making the speed of my code shorter? My compression code is below, if there are any quicker ways of doing loops, etc. please send me an answer (:
(by the way my code DOES work, so I'm not asking for corrections, just enhancements, or tips, thanks!)
import re #used to enable functions(loops, etc.) to find patterns in text file
import os #used for anything referring to directories(files)
from collections import Counter #used to keep track on how many times values are added
size1 = os.path.getsize('file.txt') #find the size(in bytes) of your file, INCLUDING SPACES
print('The size of your file is ', size1,)
words = re.findall('\w+', open('file.txt').read())
wordcounts = Counter(words) #turns all words into array, even capitals
common100 = [x for x, it in Counter(words).most_common(100)] #identifies the 200 most common words
keyword = []
kcount = []
z = dict(wordcounts)
for key, value in z.items():
keyword.append(key) #adds each keyword to the array called keywords
kcount.append(value)
characters =['$','#','#','!','%','^','&','*','(',')','~','-','/','{','[', ']', '+','=','}','|', '?','cb',
'dc','fd','gf','hg','kj','mk','nm','pn','qp','rq','sr','ts','vt','wv','xw','yx','zy','bc',
'cd','df','fg','gh','jk','km','mn','np','pq','qr','rs','st','tv','vw','wx','xy','yz','cbc',
'dcd','fdf','gfg','hgh','kjk','mkm','nmn','pnp','qpq','rqr','srs','tst','vtv','wvw','xwx',
'yxy','zyz','ccb','ddc','ffd','ggf','hhg','kkj','mmk','nnm','ppn','qqp','rrq','ssr','tts','vvt',
'wwv','xxw','yyx''zzy','cbb','dcc','fdd','gff','hgg','kjj','mkk','nmm','pnn','qpp','rqq','srr',
'tss','vtt','wvv','xww','yxx','zyy','bcb','cdc','dfd','fgf','ghg','jkj','kmk','mnm','npn','pqp',
'qrq','rsr','sts','tvt','vwv','wxw','xyx','yzy','QRQ','RSR','STS','TVT','VWV','WXW','XYX','YZY',
'DC','FD','GF','HG','KJ','MK','NM','PN','QP','RQ','SR','TS','VT','WV','XW','YX','ZY','BC',
'CD','DF','FG','GH','JK','KM','MN','NP','PQ','QR','RS','ST','TV','VW','WX','XY','YZ','CBC',
'DCD','FDF','GFG','HGH','KJK','MKM','NMN','PNP','QPQ','RQR','SRS','TST','VTV','WVW','XWX',
'YXY','ZYZ','CCB','DDC','FFD','GGF','HHG','KKJ','MMK','NNM','PPN','QQP','RRQ','SSR','TTS','VVT',
'WWV','XXW','YYX''ZZY','CBB','DCC','FDD','GFF','HGG','KJJ','MKK','NMM','PNN','QPP','RQQ','SRR',
'TSS','VTT','WVV','XWW','YXX','ZYY','BCB','CDC','DFD','FGF','GHG','JKJ','KMK','MNM','NPN','PQP',] #characters which I can use
symbols_words = []
char = 0
for i in common100:
symbols_words.append(characters[char]) #makes the array literally contain 0 values
char = char + 1
print("Compression has now started")
f = 0
g = 0
no = 0
while no < 100:
for i in common100:
for w in words:
if i == w and len(i)>1: #if the values in common200 are ACTUALLY in words
place = words.index(i)#find exactly where the most common words are in the text
symbols = symbols_words[common100.index(i)] #assigns one character with one common word
words[place] = symbols # replaces the word with the symbol
g = g + 1
no = no + 1
string = words
stringMade = ' '.join(map(str, string))#makes the list into a string so you can put it into a text file
file = open("compression.txt", "w")
file.write(stringMade)#imports everything in the variable 'words' into the new file
file.close()
size2 = os.path.getsize('compression.txt')
no1 = int(size1)
no2 = int(size2)
print('Compression has finished.')
print('Your original file size has been compressed by', 100 - ((100/no1) * no2 ) ,'percent.'
'The size of your file now is ', size2)
Using something like
word_substitutes = dict(zip(common100, characters))
will give you a dict that maps common words to their corresponding symbol.
Then you can simply iterate over the words:
# Iterate over all the words
# Use enumerate because we're going to modify the word in-place in the words list
for word_idx, word in enumerate(words):
# If the current word is in the `word_substitutes` dict, then we know its in the
# 'common' words, and can be replaced by the symbol
if word in word_substitutes:
# Replaces the word in-place
replacement_symbol = word_substitutes[word]
words[word_idx] = replacement_symbol
This will give much better performance, because the dictionary lookup used for the common word symbol mapping is logarithmic in time rather than linear. So the overall complexity will be something like O(N log(N)) rather than O(N^3) that you get from the 2 nested loops with the .index() call inside that.
The first thing I see that is bad for performance is:
for i in common100:
for w in words:
if i == w and len(i)>1:
...
What you are doing is seeing if the word w is in your list of common100 words. However, this check can be done in O(1) time by using a set and not looping through all of your top 100 words for each word.
common_words = set(common100)
for w in words:
if w in common_words:
...
Generally you would do the following:
Measure how much time each "part" of your program needs. You could use a profiler (e.g. this one in the standard library) or simply sprinkle some times.append(time.time.now) into your code and compute differences. Then you know which part of your code is slow.
See if you can improve the algorithm of the slow part. gnicholas answer shows one possibility to speed things up. The while no<=100 seems suspiciously, maybe that can be improved. This step needs understanding of the algorithms you use. Be careful to select the best data structures for your use case.
If you can't use a better algorithm (because you always use the best way to calculate something) you need to speed up the computations themselves. Numerical stuff benefits from numpy, with cython you can basically compile python code to C and numba uses LLVM to compile.

Python find longest ORF in DNA sequence

Can someone show me a straightforward solution for how to calculate the longest open reading frame (ORF) in a DNA sequence? ATG is the start codon (i.e., the beginning of an ORF) and TAG, TGA, and TAA are stop codons (i.e., the end of an ORF).
Here's some code that produces errors (and uses an external module called BioPython):
import sys
from Bio import SeqIO
currentCid = ''
buffer = []
for record in SeqIO.parse(open(sys.argv[1]),"fasta"):
cid = str(record.description).split('.')[0][1:]
if currentCid == '':
currentCid = cid
else:
if cid != currentCid:
buffer.sort(key = lambda x : len(x[1]))
print '>' + buffer[-1][0]
print buffer[-1][1]
currentCid = cid
buffer = [(str(record.description),str(record.seq))]
else:
buffer.append((str(record.description),str(record.seq)))
buffer.sort(key = lambda x : len(x[1]))
print '>' + buffer[-1][0]
print buffer[-1][1]
Is it possible to write this procedure with the least amount of external dependencies (or at least get the above code to work)?
Here's what my input looks like:
ACCGCCGCGAACATCGCCGAGATCCTGCCGCCGCAGCCGAGCCGGCTGGTCGAGTATGCGCAACGACGCG
CGTCCGGCAGCATCCCGGCGATCATGGCGCGCTGGGATGCACGCGTACTGCAGGACAACGAACCATTCAC
CGCAGTCTATGGCGGCGCGTCGTACATCAACAACGACCTGTTCCTCGCCCGCCTCGCCGACTGGGGCGTG
TCGGCCGGCAACTACAGCGGCGAGATCGGCGGCGCGACACCGCCGCTGCGCTGGCGCCCGCTGCGGCTGC
TGCGTTCGCTGCCGGTGTTCTGGCGCATGCTGCGTGTCGCGCGCGGGCACCTGCCGACGCTCGAGCGCGG
CTTGCAGCGCTTCGACCAGGAACTCGCGACGCTCGTCGAGCGACGCGCCGACGGCCAGCAACTGGCCGAC
TGGTTCACGCGCTTCTACGTGTTCGTCGTGCAGGGCAACCTGTGCATCGCGTCGTCGCTGGCCAGCAGCG
GCGGCGCACTGTGGGGCCGTCCGCCGACCGCATACGGCCAGCTCGACGACAGCCCGCACCGGCTGCCGTG
GGAAACCGATCCGGGCACCGCACGGCCCGCGCCCACCCACCTGCCGCTGCAGGCGTTTCCCGCCTGGCCG
CTGCCGGTCCGCGTGCTCCACGCGCTCGGCGCGCCCGGCATGCGCGGCTGGTATCTGCAGGTGCGCGAGT
GGTATCGCGACAACCTGATGCGCGTGTTCTTCCGCCTGCATCATGCGATGCCGGCCGCCGATCGCGACAC
GTGGTTCGCGCCCCATCCCGATCGCCGCGAACGCAACGGCAGCTTCTGGCAGGACGGCGGCGAAGGCACC
GACGAGGCAGCCGGCTTCATGATCTATCCGGGCCACACGCAAGGCGTGCTCGGCCACGACATCCTGCTGG
AAGACACGCTCGACCCGGGCCGGCACGCGCAGTACCAGGCCGCGCGCGCCGTGATCGCGCGCATGGGCGG
CCGGCTGTCGCACGGCGCGACGCTGCTGCGCGAGCTGCGCAAGCCGTCGGCCGTGCTGCCGCGCGTCGAT
GCGGCGTGGATCGGGCGCGAGGTGCGGCTCAGCGACGGCCAGCTGACGCTGGTCGAATGAACGCGATGCG
GTTGCCGCGCACCCGAGCACGGGCCCGGGCCTGAACTGCCGATCAGCGTACCGGCGTGCGGACGACTCCG
TCGACCTTCAGCGTGCGCCGGTCGTGCGCGGCTTCGTATTCGACCGTCTGCGCAGGCGTGACGGCGCCGT
ATGAATGGCCGTTCACGTAGACGGTGCCGTCCCGCAGCTCGACCCGGTCGCCGTTGACCGTCGCTGTGGC
CCGTTCACCCTGCAGCACCGCGCCCGAACAACCTGCAGTCGAAAAACTGCGGACCGACGTGCCCGGCATC
GCGGCGATCCCGCCCTGGTCCGCCGCATGCGCCGCGCTGCACGGCGGCGCATCCATGCTGCCGGCAGCGT
GGACCGCGCCGGCGCTGATGCCGCATCCGGCAAGCAGCGCAATCGTCATCGGCTTCAGATGGTTCATGGT
GAGCTCCGTTGTCCGCCGCCGCGGATCGATGACCGGCCGACGCCCGTGCTCGCATGGCAGGCCGGCCGGC
CGGATGCATCCAGTATGCGTCCGGTTCGCGGCATTCCGCCATCGTCGCCGATACCGCTCATCGCCGCCCG
GTTCGCTCCCGCAGCGGCCTCTGGAAGCACCTCCCGCGGGGCAACCCGTCCCCATGAAAATCCACCTTGA
TCAAGTTGCGACTCGCAACTATTATTGATTGCGATCCGCAACCTTTCCGGACCCGCCATGGACCTCATCG
ACGCTCCCGCCAAGCCCCGCGAAGCCACGATCCTCGAGCTGCGCGACTTCTCCCGCAAACTGGTTCGCGA
GCTCGGCTTCATGCGCGCGACGCTGGCCGACAGCGACTGGGCGCCTT
My output should be:
The longest substring that begins with ATG (i.e., the start of an ORF) and ends with either TAG, TGA, or TAA as stop codons (i.e., the end of an ORF).
You should look into regular expressions:
import re
max(re.findall(r'ATG(?:(?!TAA|TAG|TGA)...)*(?:TAA|TAG|TGA)',s), key = len)
There is a good tutorial here, that focuses on the use of regular expressions with DNA strings
Since BioPython is a well-established and widely available module that's specifically designed for these sorts of questions, there's little reason to avoid it and re-invent the wheel. That said it is useful to use regexes to identify start codons:
from Bio import Seq
import regex as re
startP = re.compile('ATG')
nuc = input_seq.replace('\n','')
longest = (0,)
for m in startP.finditer(nuc, overlapped=True):
if len(Seq.Seq(nuc)[m.start():].translate(to_stop=True)) > longest[0]:
pro = Seq.Seq(nuc)[m.start():].translate(to_stop=True)
longest = (len(pro),
m.start(),
str(pro),
nuc[m.start():m.start()+len(pro)*3+3])
Note that this uses the regex module, not the re module; the former allows easier identification of overlapping matches. We can let BioPython count triplets and look for stop codons, rather than try to labor through regexes to do that.
Here, longest yields the length of the protein encoded by the ORF, the start site (note, using 0-based numbering), the protein sequence encoded by the ORF, and the sequence of the ORF itself, including the stop codon.
(338,
93,
'MARWDARVLQDNEPFTAVYGGASYINNDLFLARLADWGVSAGNYSGEIGGATPPLRWRPLRLLRSLPVFWRMLRVARGHLPTLERGLQRFDQELATLVERRADGQQLADWFTRFYVFVVQGNLCIASSLASSGGALWGRPPTAYGQLDDSPHRLPWETDPGTARPAPTHLPLQAFPAWPLPVRVLHALGAPGMRGWYLQVREWYRDNLMRVFFRLHHAMPAADRDTWFAPHPDRRERNGSFWQDGGEGTDEAAGFMIYPGHTQGVLGHDILLEDTLDPGRHAQYQAARAVIARMGGRLSHGATLLRELRKPSAVLPRVDAAWIGREVRLSDGQLTLVE',
'ATGGCGCGCTGGGATGCACGCGTACTGCAGGACAACGAACCATTCACCGCAGTCTATGGCGGCGCGTCGTACATCAACAACGACCTGTTCCTCGCCCGCCTCGCCGACTGGGGCGTGTCGGCCGGCAACTACAGCGGCGAGATCGGCGGCGCGACACCGCCGCTGCGCTGGCGCCCGCTGCGGCTGCTGCGTTCGCTGCCGGTGTTCTGGCGCATGCTGCGTGTCGCGCGCGGGCACCTGCCGACGCTCGAGCGCGGCTTGCAGCGCTTCGACCAGGAACTCGCGACGCTCGTCGAGCGACGCGCCGACGGCCAGCAACTGGCCGACTGGTTCACGCGCTTCTACGTGTTCGTCGTGCAGGGCAACCTGTGCATCGCGTCGTCGCTGGCCAGCAGCGGCGGCGCACTGTGGGGCCGTCCGCCGACCGCATACGGCCAGCTCGACGACAGCCCGCACCGGCTGCCGTGGGAAACCGATCCGGGCACCGCACGGCCCGCGCCCACCCACCTGCCGCTGCAGGCGTTTCCCGCCTGGCCGCTGCCGGTCCGCGTGCTCCACGCGCTCGGCGCGCCCGGCATGCGCGGCTGGTATCTGCAGGTGCGCGAGTGGTATCGCGACAACCTGATGCGCGTGTTCTTCCGCCTGCATCATGCGATGCCGGCCGCCGATCGCGACACGTGGTTCGCGCCCCATCCCGATCGCCGCGAACGCAACGGCAGCTTCTGGCAGGACGGCGGCGAAGGCACCGACGAGGCAGCCGGCTTCATGATCTATCCGGGCCACACGCAAGGCGTGCTCGGCCACGACATCCTGCTGGAAGACACGCTCGACCCGGGCCGGCACGCGCAGTACCAGGCCGCGCGCGCCGTGATCGCGCGCATGGGCGGCCGGCTGTCGCACGGCGCGACGCTGCTGCGCGAGCTGCGCAAGCCGTCGGCCGTGCTGCCGCGCGTCGATGCGGCGTGGATCGGGCGCGAGGTGCGGCTCAGCGACGGCCAGCTGACGCTGGTCGAATGA')
Check this out:
https://www.kaggle.com/xiangma/orf-finder?scriptVersionId=6709465
As shown in the link above, there are two methods to do this:
Please note I set ORF length limitation above 1000bp and you can adjust it with your needs.
First one:
from Bio import SeqIO
records = SeqIO.parse('dna2.fasta', 'fasta')
for record in records:
for strand, seq in (1, record.seq), (-1, record.seq.reverse_complement()):
for frame in range(3):
length = 3 * ((len(seq)-frame) // 3)
for pro in seq[frame:frame+length].translate(table = 1).split("*")[:-1]:
if 'M' in pro:
orf = pro[pro.find('M'):]
pos = seq[frame:frame+length].translate(table=1).find(orf)*3 + frame +1
if len(orf)*3 +3 > 1300:
print("{}...{} - length {}, strand {}, frame {}, pos {}, name {}".format\
(orf[:3], orf[-3:], len(orf)*3+3, strand, frame, pos, record.id))
Second one, which uses the regex:
from Bio import SeqIO
import re
records = SeqIO.parse('dna2.fasta', 'fasta')
for record in records:
for strand, seq in (1, record.seq), (-1, record.seq.reverse_complement()):
for frame in range(3):
index = frame
while index < len(record) - 6:
match = re.match('(ATG(?:\S{3})*?T(?:AG|AA|GA))', str(seq[index:]))
if match:
orf = match.group()
index += len(orf)
if len(orf) > 1300:
pos = str(record.seq).find(orf) + 1
print("{}...{} - length {}, strand {}, frame {}, pos {}, name {}".format\
(orf[:6], orf[-3:], len(orf), strand, frame, pos, record.id))
else: index += 3

Parsing through sequence output- Python

I have this data from sequencing a bacterial community.
I know some basic Python and am in the midst of completing the codecademy tutorial.
For practical purposes, please think of OTU as another word for "species"
Here is an example of the raw data:
OTU ID OTU Sum Lineage
591820 1083 k__Bacteria; p__Fusobacteria; c__Fusobacteria; o__Fusobacteriales; f__Fusobacteriaceae; g__u114; s__
532752 517 k__Bacteria; p__Fusobacteria; c__Fusobacteria; o__Fusobacteriales; f__Fusobacteriaceae; g__u114; s__
218456 346 k__Bacteria; p__Proteobacteria; c__Betaproteobacteria; o__Burkholderiales; f__Alcaligenaceae; g__Bordetella; s__
590248 330 k__Bacteria; p__Proteobacteria; c__Betaproteobacteria; o__Burkholderiales; f__Alcaligenaceae; g__; s__
343284 321 k__Bacteria; p__Proteobacteria; c__Betaproteobacteria; o__Burkholderiales; f__Comamonadaceae; g__Limnohabitans; s__
The data includes three things: a reference number for the species, how many times that species is in the sample, and the taxonomy of said species.
What I'm trying to do is add up all the times a sequence is found for a taxonomic family (designated as f_x in the data).
Here is an example of the desired output:
f__Fusobacteriaceae 1600
f__Alcaligenaceae 676
f__Comamonadaceae 321
This isn't for a class. I started learning python a few months ago, so I'm at least capable of looking up any suggestions. I know how it works out from doing it the slow way (copy & paste in excel), so this is for future reference.
If the lines in your file really look like this, you can do
from collections import defaultdict
import re
nums = defaultdict(int)
with open("file.txt") as f:
for line in f:
items = line.split(None, 2) # Split twice on any whitespace
if items[0].isdigit():
key = re.search(r"f__\w+", items[2]).group(0)
nums[key] += int(items[1])
Result:
>>> nums
defaultdict(<type 'int'>, {'f__Comamonadaceae': 321, 'f__Fusobacteriaceae': 1600,
'f__Alcaligenaceae': 676})
Yet another solution, using collections.Counter:
from collections import Counter
counter = Counter()
with open('data.txt') as f:
# skip header line
next(f)
for line in f:
# Strip line of extraneous whitespace
line = line.strip()
# Only process non-empty lines
if line:
# Split by consecutive whitespace, into 3 chunks (2 splits)
otu_id, otu_sum, lineage = line.split(None, 2)
# Split the lineage tree into a list of nodes
lineage = [node.strip() for node in lineage.split(';')]
# Extract family node (assuming there's only one)
family = [node for node in lineage if node.startswith('f__')][0]
# Increase count for this family by `otu_sum`
counter[family] += int(otu_sum)
for family, count in counter.items():
print "%s %s" % (family, count)
See the docs for str.split() for the details of the None argument (matching consecutive whitespace).
Get all your raw data and process it first, I mean structure it and then use the structured data to do any sort of operations you desire.
In case if you have GB's of data you can use elasticsearch. Feed your raw data and query with your required string in this case f_* and get all entries and add them
That's very doable with basic python. Keep the Library Reference under your pillow, as you'll want to refer to it often.
You'll likely end up doing something similar to this (I'll write it the longer-more-readable way -- there's ways to compress the code and do this quicker).
# Open up a file handle
file_handle = open('myfile.txt')
# Discard the header line
file_handle.readline()
# Make a dictionary to store sums
sums = {}
# Loop through the rest of the lines
for line in file_handle.readlines():
# Strip off the pesky newline at the end of each line.
line = line.strip()
# Put each white-space delimited ... whatever ... into items of a list.
line_parts = line.split()
# Get the first column
reference_number = line_parts[0]
# Get the second column, convert it to an integer
sum = int(line_parts[1])
# Loop through the taxonomies (the rest of the 'columns' separated by whitespace)
for taxonomy in line_parts[2:]:
# skip it if it doesn't start with 'f_'
if not taxonomy.startswith('f_'):
continue
# remove the pesky semi-colon
taxonomy = taxonomy.strip(';')
if sums.has_key(taxonomy):
sums[taxonomy] += int(sum)
else:
sums[taxonomy] = int(sum)
# All done, do some fancy reporting. We'll leave sorting as an exercise to the reader.
for taxonomy in sums.keys():
print("%s %d" % (taxonomy, sums[taxonomy]))

Categories