Split string when a certain character is read - python

I have several strings stored in a file one per line like this:
dsfsdfsd/mhgjghj
cvcv/xcvxc
werwr/erewrwer
nbmbn/iuouiouio
...
As you can see the only character that is always present is the backlash /, the rest being pretty random in its composition. I need to store the first and second part (ie: before and after the backlash respectively) of each line separately, so as to end up with something like this:
first_list = [dsfsdfsd, cvcv, werwr, nbmbn, ...]
secnd_list = [mhgjghj, xcvxc, erewrwer, iuouiouio, ...]
I could do this in python iterating through each line, checking for the existence of the backlash and storing the contents of each part of the line separately. It would look like this:
first_list, secnd_list = [], []
for line in file:
for indx, char in enumerate(line):
if char == '/':
first_list.append(line[:(indx-1)])
secnd_list.append(line[(indx-1):])
break
I'm looking for a prettier (more pythonic) version of this code.

split() might come in handy here:
first_list, secnd_list = [], []
for line in file:
first, second = line.split('/')
first_list.append(first)
secnd_list.append(second)
One of the assumptions made here is that only a single / is present. Knowning that, split('/') will always return a 2-tuple of elements. If this assumption is false, try split('/', 1) instead - it limits the number of splits to 1, counting left-to-right.

As well as str.split you could use str.partition:
first_parts = []
second_parts = []
for line in file:
before, _, after = line.partition('/')
first_parts.append(before)
second_parts.append(after)
An alternative more functional oneliner:
first_parts, _, second_parts = zip(*(line.partition('/') for line in file))
Explanation for the _ in both options - str.partition returns a tuple: (first_part, seperator, last_part). Here, we don't need the seperator (indeed I can't imagine why you ever would), so we assign it to the throwaway variable _.
Here are the docs for str.partition, and here are the docs for str.split.

Related

Print a list of unique words from a text file after removing punctuation, and find longest word

Goal is to a) print a list of unique words from a text file and also b) find the longest word.
I cannot use imports in this challenge.
File handling and main functionality are what I want, however the list needs to be cleaned. As you can see from the output, words are getting joined with punctuation and therefore maxLength is obviously incorrect.
with open("doc.txt") as reader, open("unique.txt", "w") as writer:
unwanted = "[],."
unique = set(reader.read().split())
unique = list(unique)
unique.sort(key=len)
regex = [elem.strip(unwanted).split() for elem in unique]
writer.write(str(regex))
reader.close()
maxLength = len(max(regex,key=len ))
print(maxLength)
res = [word for word in regex if len(word) == maxLength]
print(res)
===========
Sample:
pioneered the integrated placement year concept over 50 years ago [7][8][9] with more than 70 per cent of students taking a placement year, the highest percentage in the UK.[10]
Here's a solution that uses str.translate() to throw away all bad characters (+ newline) before we ever do the split(). (Normally we'd use a regex with re.sub(), but you're not allowed.) This makes the cleaning a one-liner, which is really neat:
bad = "[],.\n"
bad_transtable = str.maketrans(bad, ' ' * len(bad))
# We can directly read and clean the entire output, without a reader object:
cleaned_input = open('doc.txt').read().translate(bad_transtable)
#with open("doc.txt") as reader:
# cleaned_input = reader.read().translate(bad_transtable)
# Get list of unique words, in decreasing length
unique_words = sorted(set(cleaned_input.split()), key=lambda w: -len(w))
with open("unique.txt", "w") as writer:
for word in unique_words:
writer.write(f'{word}\n')
max_length = len(unique_words[0])
print ([word for word in unique_words if len(word) == max_length])
Notes:
since the input is already 100% cleaned and split, no need to append to a list/insert to a set as we go, then have to make another cleaning pass later. We can just create unique_words directly! (using set() to keep only uniques). And while we're at it, we might as well use sorted(..., key=lambda w: -len(w)) to sort it in decreasing length. Only need to call sort() once. And no iterative-append to lists.
hence we guarantee that max_length = len(unique_words[0])
this approach is also going to be more performant than nested loops for line in <lines>: for word in line.split(): ...iterative append() to wordlist
no need to do explicit writer/reader.open()/.close(), that's what the with statement does for you. (It's also more elegant for handling IO when exceptions happen.)
you could also merge the printing of the max_length words inside the writer loop. But it's cleaner code to keep them separate.
note we use f-string formatting f'{word}\n' to add the newline back when we write() an output line
in Python we use lower_case_with_underscores for variable names, hence max_length not maxLength. See PEP8
in fact here, we don't strictly need a with-statement for the writer, if all we're going to do is slurp its entire contents in one go in with open('doc.txt').read(). (That's not scaleable for huge files, you'd have to read in chunks or n lines).
str.maketrans() is a builtin, but if your teacher objects to the module reference, you can also call it on a bound string e.g. ' '.maketrans()
str.maketrans() is really a throwback to the days when we only had 95 printable ASCII characters, not Unicode. It still works on Unicode, but building and using huge translation dicts is annoying and uses memory, regex on Unicode is easier, you can define entire character classes.
Alternative solution if you don't yet know str.translate()
dirty_input = open('doc.txt').read()
cleaned_input = dirty_input
# If you can't use either 're.sub()' or 'str.translate()', have to manually
# str.replace() each bad char one-by-one (or else use a method like str.isalpha())
for bad_char in bad:
cleaned_input = cleaned_input.replace(bad_char, ' ')
And if you wanted to be ridiculously minimalist, you could write the entire output file in one line with a list-comprehension. Don't do this, it would be terrible for debugging, e.g if you couldn't open/write/overwrite the output file, or got IOError, or unique_words wasn't a list, etc:
open("unique.txt", "w").writelines([f'{word}\n' for word in unique_words])
Here is another solution without any function.
bad = '`~##$%^&*()-_=+[]{}\|;\':\".>?<,/?'
clean = ' '
for i in a:
if i not in bad:
clean += i
else:
clean += ' '
cleans = [i for i in clean.split(' ') if len(i)]
clean_uniq = list(set(cleans))
clean_uniq.sort(key=len)
print(clean_uniq)
print(len(clean_uniq[-1]))
Here is a solution. The trick is to use the python str method .isalpha() to filter non-alphanumerics.
with open("unique.txt", "w") as writer:
with open("doc.txt") as reader:
cleaned_words = []
for line in reader.readlines():
for word in line.split():
cleaned_word = ''.join([c for c in word if c.isalpha()])
if len(cleaned_word):
cleaned_words.append(cleaned_word)
# print unique words
unique_words = set(cleaned_words)
print(unique_words)
# write words to file? depends what you need here
for word in unique_words:
writer.write(str(word))
writer.write('\n')
# print length of longest
print(len(sorted(unique_words, key=len, reverse=True)[0]))

In Python, how to match a string to a dictionary item (like 'Bra*')

I'm a complete novice at Python so please excuse me for asking something stupid.
From a textfile a dictionary is made to be used as a pass/block filter.
The textfile contains addresses and either a block or allow like "002029568,allow" or "0011*,allow" (without the quotes).
The search-input is a string with a complete code like "001180000".
How can I evaluate if the search-item is in the dictionary and make it match the "0011*,allow" line?
Thank you very much for your efford!
The filter-dictionary is made with:
def loadFilterDict(filename):
global filterDict
try:
with open(filename, "r") as text_file:
lines = text_file.readlines()
for s in lines:
fields = s.split(',')
if len(fields) == 2:
filterDict[fields[0]] = fields[1].strip()
text_file.close()
except:
pass
Check if the code (ccode) is in the dictionary:
if ccode in filterDict:
if filterDict[ccode] in ['block']:
continue
else:
if filterstat in ['block']:
continue
The filters-file is like:
002029568,allow
000923993,allow
0011*, allow
If you can use re, you don't have to worry about the wildcard but let re.match do the hard work for you:
# Rules input (this could also be read from file)
lines = """002029568,allow
0011*,allow
001180001,block
"""
# Parse rules from string
rules = []
for line in lines.split("\n"):
line = line.strip()
if not line:
continue
identifier, ruling = line.split(",")
rules += [(identifier, ruling)]
# Get rulings for specific number
def rule(number):
from re import match
rulings = []
for identifier, ruling in rules:
# Replace wildcard with regex .*
identifier = identifier.replace("*", ".*")
if match(identifier, number):
rulings += [ruling]
return rulings
print(rule("001180000"))
print(rule("001180001"))
Which prints:
['allow']
['allow', 'block']
The function will return a list of rulings. Their order is the same order as they appear in your config lines. So you could easily just pick the last or first ruling whichever is the one you're interested in.
Or break the loop prematurely if you can assume that no two rulings will interfere.
Examples:
001180000 is matched by 0011*,allow only, so the only ruling which applies is allow.
001180001 is matched by 0011*,allow at first, so you'll get allow as before. However, it is also matched by 001180001,block, so a block will get added to the rulings, too.
If the wildcard entries in the file have a fixed length (for example, you only need to support lines like 0011*,allow and not 00110*,allow or 0*,allow or any other arbitrary number of digits followed by *) you can use a nested dictionary, where the outer keys are the known parts of the wildcarded entries.
d = {'0011': {'001180000': 'value', '001180001': 'value'}}
Then when you parse the file and get to the line 0011*,allow you do not need to do any matching. All you have to do is check if '0011' is present. Crude example:
d = {'0011': {'001180000': 'value', '001180001': 'value'}}
line = '0011*,allow'
prefix = line.split(',')[0][:-1]
if prefix in d:
# there is a "match", then you can deal with all the entries that match,
# in this case the items in the inner dictionary
# {'001180000': 'value', '001180001': 'value'}
print('match')
else:
print('no match')
If you do need to support arbitrary lengths of wildcarded entries, you will have to resort to a loop iterating over the dictionary (and therefore beating the point of using a dictionary to begin with):
d = {'001180000': 'value', '001180001': 'value'}
line = '0011*,allow'
prefix = line.split(',')[0][:-1]
for k, v in d.items():
if k.startswith(prefix):
# found matching key-value pair
print(k, v)

Python Re-ordering the lines in a dat file by string

Sorry if this is a repeat but I can't find it for now.
Basically I am opening and reading a dat file which contains a load of paths that I need to loop through to get certain information.
Each of the lines in the base.dat file contains m.somenumber. For example some lines in the file might be:
Volumes/hard_disc/u14_cut//u14m12.40_all.beta/beta8
Volumes/hard_disc/u14_cut/u14m12.50_all.beta/beta8
Volumes/hard_disc/u14_cut/u14m11.40_all.beta/beta8
I need to be able to re-write the dat file so that all the lines are re-ordered from the largest m.number to the smallest m.number. Then when I loop through PATH in database (shown in code) I am looping through in decreasing m.
Here is the relevant part of the code
base = open('base8.dat', 'r')
database= base.read().splitlines()
base.close()
counter=0
mu_list=np.array([])
delta_list=np.array([])
ofsset = 0.00136
beta=0
for PATH in database:
if os.path.exists(str(PATH)+'/CHI/optimal_spectral_function_CHI.dat'):
n1_array = numpy.loadtxt(str(PATH)+'/AVERAGES/av-err.n.dat')
n7_array= numpy.loadtxt(str(PATH)+'/AVERAGES/av-err.npx.dat')
n1_mean = n1_array[0]
delta=round(float(5.0+ofsset-(n1_array[0]*2.+4.*n7_array[0])),6)
par = open(str(PATH)+"/params10", "r")
for line in par:
counter= counter+1
if re.match("mu", line):
mioMU= re.findall('\d+', line.translate(None, ';'))
mioMU2=line.split()[2][:-1]
mu=mioMU2
print mu, delta, PATH
mu_list=np.append(mu_list, mu)
delta_list=np.append(delta_list,delta)
optimal_counter=0
print delta_list, mu_list
I have checked the possible flagged repeat but I can't seem to get it to work for mine because my file doesn't technically contain strings and numbers. The 'number' I need to sort by is contained in the string as a whole:
Volumes/data_disc/u14_cut/from_met/u14m11.40_all.beta/beta16
and I need to sort the entire line by just the m(somenumber) part
Assuming that the number part of your line has the form of a float you can use a regular expression to match that part and convert it from string to float.
After that you can use this information in order to sort all the lines read from your file. I added a invalid line in order to show how invalid data is handled.
As a quick example I would suggest something like this:
import re
# TODO: Read file and get list of lines
l = ['Volumes/hard_disc/u14_cut/u14**m12.40**_all.beta/beta8',
'Volumes/hard_disc/u14_cut/u14**m12.50**_all.beta/beta8',
'Volumes/hard_disc/u14_cut/u14**m11.40**_all.beta/beta8',
'Volumes/hard_disc/u14_cut/u14**mm11.40**_all.beta/beta8']
regex = r'^.+\*{2}m{1}(?P<criterion>[0-9\.]*)\*{2}.+$'
p = re.compile(regex)
criterion_list = []
for s in l:
m = p.match(s)
if m:
crit = m.group('criterion')
try:
crit = float(crit)
except Exception as e:
crit = 0
else:
crit = 0
criterion_list.append(crit)
tuples_list = list(zip(criterion_list, l))
output = [element[1] for element in sorted(tuples_list, key=lambda t: t[0])]
print(output)
# TODO: Write output to new file or overwrite existing one.
Giving:
['Volumes/hard_disc/u14_cut/u14**mm11.40**_all.beta/beta8', 'Volumes/hard_disc/u14_cut/u14**m11.40**_all.beta/beta8', 'Volumes/hard_disc/u14_cut/u14**m12.40**_all.beta/beta8', 'Volumes/hard_disc/u14_cut/u14**m12.50**_all.beta/beta8']
This snippets starts after all lines are read from the file and stored into a list (list called l here). The regex group criterion catches the float part contained in **m12.50** as you can see on regex101. So iterating through all the lines gives you a new list containing all matching groups as floats. If the regex does not match on a given string or casting the group to a float fails, crit is set to zero in order to have those invalid lines at the very beginning of the sorted list later.
After that zip() is used to get a list of tules containing the extracted floats and the according string. Now you can sort this list of tuples based on the tuple's first element and write the according string to a new list output.

Trying to split a txt file into multiple variables

So I'm making a program where it reads a text file and I need to separate all the info into their own variables. It looks like this:
>1EK9:A.41,52; B.61,74; C.247,257; D.279,289
ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD
YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ
DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT
QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN
YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE
QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN
KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS
SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT
TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV
STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN
The code after the > is a title, the next bit that looks like this "A.41,52" are numbered positions in the sequence I need to save to use, and everything after that is an amino acid sequence. I know how to deal with the amino acid sequence, I just need to know how to separate the important numbers in the first line.
In the past when I just had a title and sequence I did something like this:
for line in nucfile:
if line.startswith(">"):
headerline=line.strip("\n")[1:]
else:
nucseq+=line.strip("\n")
Am I on the right track here? This is my first time, any advice would be fantastic and thanks for reading :)
I suggest you use the split() method.
split() allows you to specify the separator of your choice. Provided the sequence title (here 1EK9) is always separated from the rest of the sequence by a colon, you could first pass ":" as your separator. You could then split the remainder of the sequence to recover the numbered positions (e.g. A.41,52) using ";" as a separator.
I hope this helps!
I think what you are trying to do is extract certain parts of the sequence based on their identifiers given to you on the first line (the line starting with >).
This line contains your title, then a sequence name and the data range you need to extract.
Try this:
sequence_pairs = {}
with open('somefile.txt') as f:
header_line = next(f)
sequence = f.read()
title,components = header_line.split(':')
pairs = components.split(';')
for pair in pairs:
start,end = pair[2:-1].split(',')
sequence_pars[pair[:1]] = sequence[start:int(end)+1]
for sequence,data in sequence_pairs.iteritems():
print('{} - {}'.format(sequence, data))
As the other answer may be very good to tackle the assumed problem in it's entirety - but the OP has requested for pointers or an example of the tpyical split-unsplit transform which is often so successful I hereby provide some ideas and working code to show this (based on the example of the question).
So let us focus on the else branch below:
from __future__ import print_function
nuc_seq = [] # a list
title_token = '>'
with open('some_file_of_a_kind.txt', 'rt') as f:
for line in f.readlines():
s_line = line.strip() # this strips whitespace
if line.startswith(title_token):
headerline = line.strip("\n")[1:]
else:
nuc_seq.append(s_line) # build list
# now nuc_seq is a list of strings like:
# ['ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD',
# 'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ',
# ...
# ]
demo_nuc_str = ''.join(nuc_seq)
# now:
# demo_nuc_str == 'ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYR ...'
That is fast and widely deployed paradigm in Python programming (and programming with powerful datatypes in general).
If the split-unsplit ( a.k.a. join) method is still unclear, just ask or try to sear SO on excellent answers to related questions.
Also note, that there is no need to line.strip('\n') as \nis considered whitespace like ' ' (string with a space only) or a tabulator '\t', sample:
>>> a = ' \t \n '
>>> '+'.join(a.split())
''
So the "joining character" only appears, if there are at least two element sto join and in this case, strip removed all whits space and left us with the empty string.
Upate:
As requested a further analysis of the "coordinate part" in the line called headline of the question:
>1EK9:A.41,52; B.61,74; C.247,257; D.279,289
If you want to retrieve the:
A.41,52; B.61,74; C.247,257; D.279,289
and assume you have (as above the complete line in headline string):
title, coordinate_string = headline.split(':')
# so now title is '1EK9' and
# coordinates == 'A.41,52; B.61,74; C.247,257; D.279,289'
Now split on the semi colons, trim the entries:
het_seq = [z.strip() for z in coordinates.split(';')]
# now het_seq == ['A.41,52', 'B.61,74', 'C.247,257', 'D.279,289']
If 'a', 'B', 'C', and 'D' are well known dimensions, than you can "lose" the ordering info from input file (as you could always reinforce what you already know ;-) and might map the coordinats as key: (ordered coordinate-pair):
>>> coord_map = dict(
(a, tuple(int(k) for k in bc.split(',')))
for a, bc in (abc.split('.') for abc in het_seq))
>>> coord_map
{'A': (41, 52), 'C': (247, 257), 'B': (61, 74), 'D': (279, 289)}
In context of a micro program:
#! /usr/bin/enc python
from __future__ import print_function
het_seq = ['A.41,52', 'B.61,74', 'C.247,257', 'D.279,289']
coord_map = dict(
(a, tuple(int(k) for k in bc.split(',')))
for a, bc in (abc.split('.') for abc in het_seq))
print(coord_map)
yields:
{'A': (41, 52), 'C': (247, 257), 'B': (61, 74), 'D': (279, 289)}
Here one might write this explicit a nested for loop but it is a late european evening so trick is to read it from right:
for all elements of het_seq
split on the dot and store left in a and right in b
than further split the bc into a sequence of k's, convert to integer and put into tuple (ordered pair of integer coordinates)
arrived on the left you build a tuple of the a ("The dimension like 'A' and the coordinate tuple from 3.
In the end call the dict() function that constructs a dictionary using here the form dict(key_1, value_1, hey_2, value_2, ...) which gives {key_1: value1, ...}
So all coordinates are integers, stored ordered pairs as tuples.
I'ld prefer tuples here, although split() generates lists, because
You will keep those two coordinates not extend or append that pair
In python mapping and remapping is often performed and there a hashable (that is immutable type) is ready to become a key in a dict.
One last variant (with no knoted comprehensions):
coord_map = {}
for abc in het_seq:
a, bc = abc.split('.')
coord_map[a] = tuple(int(k) for k in bc.split(','))
print(coord_map)
The first four lines produce the same as above minor obnoxious "one liner" (that already had been written on three lines kept together within parentheses).
HTH.
So I'm assuming you are trying to process a Fasta like file and so the way I would do it is to first get the header and separate the pieces with Regex. Following that you can store the A:42.52 B... in a list for easy access. The code is as follows.
import re
def processHeader(line):
positions = re.search(r':(.*)', line).group(1)
positions = positions.split('; ')
return positions
dnaSeq = ''
positions = []
with open('myFasta', 'r') as infile:
for line in infile:
if '>' in line:
positions = processHeader(line)
else:
dnaSeq += line.strip()
I am not sure I completely understand the goal (and I think this post is more suitable for a comment, but I do not have enough privileges) but I think that the key to you solution is using .split(). You can then join the elements of the resulting list just by using + similar to this:
>>> result = line.split(' ')
>>> result
['1EK9:A.41,52;', 'B.61,74;', 'C.247,257;', 'D.279,289', 'ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD', 'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ', 'DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT', 'QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN',
'YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE', 'QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN', 'KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS', 'SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT', 'TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV', 'STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN']
>>> result[3]+result[4]
'D.279,289ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGAD'
>>>
etc. You can also use the usual following syntax to extract the elements of the list that you need:
>>> result[5:]
['YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQ', 'DVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTT', 'QRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGN', 'YYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLARE', 'QIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQN', 'KVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRS', 'SFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDAT', 'TTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPV', 'STNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN']
and join them together:
>>> reduce(lambda x, y: x+y, result[5:])
'YTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALSKPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN'
remember that + on lists produces a list.
By the way I would not remove '\n' to start with as you may try to use it to extract the first line similar to the above with using space to extract "words".
UPDATE (starting from result):
#getting A indexes
letter_seq=result[5:]
ind=result[:4]
Aind=ind[0].split('.')[1].replace(';', '')
#getting one long letter seq
long_letter_seq=reduce(lambda x, y: x+y, letter_seq)
#extracting the final seq fromlong_letter_seq using Aind
output = long_letter_seq[int(Aind.split(',')[0]):int(Aind.split(',')[1])]
the last line is just a union of several operations that were also used earlier.
Same for B C D etc -- so a lot of manual work and calculations...
BE CAREFUL with indexes of A -- numbering in python starts from 0 which may not be the case in your numbering system.
The more elegant solution would be using re (https://docs.python.org/2/library/re.html) to find pettern using a mask, but this requires very well defined rules for how to look up the sequence needed.
UPDATE2: it is also not clear to me what is the role of spaces -- so far I removed them but they may matter when counting the letters in the original string.

In Python,if startswith values in tuple, I also need to return which value

I have an area codes file I put in a tuple
for line1 in area_codes_file.readlines():
if area_code_extract.search(line1):
area_codes.append(area_code_extract.search(line1).group())
area_codes = tuple(area_codes)
and a file I read into Python full of phone numbers.
If a phone number starts with one of the area codes in the tuple, I need to do to things:
1 is to keep the number
2 is to know which area code did it match, as need to put area codes in brackets.
So far, I was only able to do 1:
for line in txt.readlines():
is_number = phonenumbers.parse(line,"GB")
if phonenumbers.is_valid_number(is_number):
if line.startswith(area_codes):
print (line)
How do I do the second part?
The simple (if not necessarily highest performance) approach is to check each prefix individually, and keep the first match:
for line in txt:
is_number = phonenumbers.parse(line,"GB")
if phonenumbers.is_valid_number(is_number):
if line.startswith(area_codes):
print(line, next(filter(line.startswith, area_codes)))
Since we know filter(line.startswith, area_codes) will get exactly one hit, we just pull the hit using next.
Note: On Python 2, you should start the file with from future_builtins import filter to get the generator based filter (which will also save work by stopping the search when you get a hit). Python 3's filter already behaves like this.
For potentially higher performance, the way to both test all prefixes at once and figure out which value hit is to use regular expressions:
import re
# Function that will match any of the given prefixes returning a match obj on hit
area_code_matcher = re.compile(r'|'.join(map(re.escape, area_codes))).match
for line in txt:
is_number = phonenumbers.parse(line,"GB")
if phonenumbers.is_valid_number(is_number):
# Returns None on miss, match object on hit
m = area_code_matcher(line)
if m is not None:
# Whatever matched is in the 0th grouping
print(line, m.group())
Lastly, one final approach you can use if the area codes are of fixed length. Rather than using startswith, you can slice directly; you know the hit because you sliced it off yourself:
# If there are a lot of area codes, using a set/frozenset will allow much faster lookup
area_codes_set = frozenset(area_codes)
for line in txt:
is_number = phonenumbers.parse(line,"GB")
if phonenumbers.is_valid_number(is_number):
# Assuming lines that match always start with ###
if line[:3] in area_codes_set:
print(line, line[:3])

Categories